PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV17130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family NF-YA
Protein Properties Length: 287aa    MW: 31533.6 Da    PI: 10.4343
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV17130.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA93.52.5e-29137191358
   CBFB_NFYA   3 plYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                 p++VNaKQy++Il+RR +Rak+e e+kl +k rkp+lh SRh hA+rRpRgsgGrF
  KZV17130.1 137 PIFVNAKQYNGILRRRRSRAKAEMESKL-TKPRKPFLHLSRHLHAMRRPRGSGGRF 191
                 9***************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005219.6E-32133194IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115233.275134194IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.6E-26137191IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.7E-21137159IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860139159IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.7E-21168191IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MTMHTEFLKE DDGIHVPNPI NGGGVLLSAV PRWPGLGSDR PYCESFIQSK IISSSSLDLN  60
DFSTAANKLM QPDNRMAKGS ATRFTISSGY DFGDCKTAEN REKNRAQTEN QGHLELGFGQ  120
SLGRIMLPLS MSADGGPIFV NAKQYNGILR RRRSRAKAEM ESKLTKPRKP FLHLSRHLHA  180
MRRPRGSGGR FLNTKKSSMS TKNGDEKEEW FAQPAESQVS VVLQSDGNRS TSPTSDATSH  240
LFSKGNASTF LPFHINHLRS NSFQPFPNVT HDTGIGIGIG IGIGFPI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-16137197464NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011094246.18e-65PREDICTED: nuclear transcription factor Y subunit A-10
TrEMBLA5PGU02e-67A5PGU0_ANTMA; YA1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37062347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.33e-30nuclear factor Y, subunit A10